General Information

  • ID:  hor001686
  • Uniprot ID:  P19802
  • Protein name:  PN
  • Gene name:  NA
  • Organism:  Lymnaea stagnalis (Great pond snail) (Helix stagnalis)
  • Family:  FARP (FMRFamide related peptide) family
  • Source:  Animal
  • Expression:  Expressed in 280 cells of the CNS including the EGP heart excitatory motoneurons.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lymnaea (genus), Lymnaeidae (family), Lymnaeoidea (superfamily), Hygrophila, Panpulmonata, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SEQPDVDDYLRDVVLQSEEPLY
  • Length:  22(82-103)
  • Propeptide:  MKTWSHVALLACLSIKWLTCVMADSIYCDDPDMCSMTKRFLRFGRALDTTDPFIRLRRQFYRIGRGGYQPYQDKRFLRFGRSEQPDVDDYLRDVVLQSEEPLYRKRRSTEAGGQSEEMTHRTARSAPEPAAENREIMKRETGAEDLDEEKRFMRFGRGDEEAEKRFMRFGKSFMRFGRDMSDVDKRFMRFGKRFMRFGREPGTDKRFMRFGREPGADKRFMRFGKSFDGEEENDDDLYYNESDADSNDDVDKRFM
  • Signal peptide:  MKTWSHVALLACLSIKWLTCVMADSIYCDDPDMCS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Induces contractions in visceral and somatic musculature as well as in the heart. May play a role as cotransmitters or modulators in a number of significant neuronal systems
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01048-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P01048-F1.pdbhor001686_AF2.pdbhor001686_ESM.pdb

Physical Information

Mass: 298454 Formula: C114H173N27O43
Absent amino acids: ACFGHIKMNTW Common amino acids: D
pI: 3.45 Basic residues: 1
Polar residues: 4 Hydrophobic residues: 6
Hydrophobicity: -88.18 Boman Index: -6151
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 92.73
Instability Index: 10142.27 Extinction Coefficient cystines: 2980
Absorbance 280nm: 141.9

Literature

  • PubMed ID:  7904219
  • Title:  Processing of the FMRFamide precursor protein in the snail Lymnaea stagnalis: characterization and neuronal localization of a novel peptide, 'SEEPLY'.